Host taxon 10090
Protein NP_001240641.1
mitochondrial peptide methionine sulfoxide reductase isoform 1
Mus musculus
Gene Msra, UniProt Q9D6Y7
>NP_001240641.1|Pseudomona aeruginosa PA01|mitochondrial peptide methionine sulfoxide reductase isoform 1
MLSASRRALQLLSSANPVRRMGDSASKVISAEEALPGRTEPIPVTAKHHVSGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGHTRNPTYKEVCSEKTGHAEVVRVVYRPEHISFEELLKVFWENHDPTQGMRQGNDFGTQYRSAVYPTSAVQMEAALRSKEEYQKVLSKHNFGPITTDIREGQVFYYAEDYHQQYLSKNPDGYCGLGGTGVSCPMAIKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.89 | 1.88788579667 | 2.0e-20 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)