Host taxon 10090
Protein NP_001152747.1
mitochondrial ornithine transporter 2
Mus musculus
Gene Slc25a2, UniProt Q99ML6
>NP_001152747.1|Pseudomona aeruginosa PA01|mitochondrial ornithine transporter 2
MQTFPQLYKGLADCFLKTYNQVGIRGLYRGTSPALLAYVTQGSVLFMCFGFCQQFVRKVARVEQNAELNDLETATAGSLASAFAALALCPTELVKCRLQTMYEMKMSGKIAQSYNTIWSMVKSIFMKDGPLGFYRGLSTTLAQEIPGYFFYFGGYEISRSFFASGGSKDELGPVPLMLSGGFAGICLWLIIFPVDCIKSRIQVLSMFGKPAGLIETFISVVRNEGISALYSGLKATLIRAIPSNAALFLVYEYSRKMMMNMVEEY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.56 | 2.56372722348803 | 0.00027 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)