Host taxon 10090
Protein NP_081134.2
mitochondrial inner membrane protease ATP23 homolog isoform 2
Mus musculus
Gene Atp23, UniProt Q9CWQ3
>NP_081134.2|Pseudomona aeruginosa PA01|mitochondrial inner membrane protease ATP23 homolog isoform 2
MAGAPGGGELGPAAGEPLLQRPDSGQGSPEPPAHGKPQQGFLSSLFTRDQSCPLMLQKTLDTNPYVKLLLDAMKHSGCAVNRGRHFSCEVCDGNVSGGFDASTSQIVLCENNIRNQAHMGRVVTHELIHAFDHCRAHVHWFTNIRHLACSEIRAASLSGDCSLVNELFRLRFGLKQHHQIETSCVSRPAMNSQSCLGLVSA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.33 | -2.3265808926907 | 0.0035 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)