Host taxon 10090
Protein NP_079670.1
mitochondrial import receptor subunit TOM7 homolog
Mus musculus
Gene Tomm7, UniProt Q9D173
>NP_079670.1|Pseudomona aeruginosa PA01|mitochondrial import receptor subunit TOM7 homolog
MVKLSKEAKQRLQQLFKGGQFAIRWGFIPLVIYLGFTRGADPGMPEPSVLSLLWG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.9 | -0.897536274329192 | 0.015 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)