Host taxon 10090
Protein NP_077176.1
mitochondrial import receptor subunit TOM20 homolog
Mus musculus
Gene Tomm20, UniProt Q9DCC8
>NP_077176.1|Pseudomona aeruginosa PA01|mitochondrial import receptor subunit TOM20 homolog
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.09 | 1.0945483525928 | 3.1e-14 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)