Host taxon 10090
Protein NP_058593.2
mitochondrial import inner membrane translocase subunit Tim23
Mus musculus
Gene Timm23, UniProt Q9CXU4
>NP_058593.2|Pseudomona aeruginosa PA01|mitochondrial import inner membrane translocase subunit Tim23
MEGGGGSSNKSTSGLAGFFGAGGAGYSNADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQSMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLAGLTLTSLYALYNNWEHMKGSLLQQSL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.26 | 1.26404953237176 | 0.00014 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)