Host taxon 10090
Protein NP_038923.1
mitochondrial import inner membrane translocase subunit Tim13
Mus musculus
Gene Timm13, UniProt P62075
>NP_038923.1|Pseudomona aeruginosa PA01|mitochondrial import inner membrane translocase subunit Tim13
MDSGFGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.31 | -1.3129201197497 | 0.00018 | 32071273 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)