Host taxon 10090
Protein NP_001277212.1
mitochondrial cardiolipin hydrolase isoform a
Mus musculus
Gene Pld6, UniProt Q5SWZ9
>NP_001277212.1|Pseudomona aeruginosa PA01|mitochondrial cardiolipin hydrolase isoform a
MGRSSWRLVFAAGAGLALALEALPWLMRWLLAGRRPRREVLFFPSQVTCTEALLQAPGLPPGPSGCPCSLPHSESSLSRLLRALLAARSSLELCLFAFSSPQLGRAVQLLHQRGVRVRVITDCDYMALNGSQIGLLRKAGIQVRHDQDLGYMHHKFAIVDKKVLITGSLNWTTQAIQNNRENVLIMEDTEYVRLFLEEFERIWEEFDPTKYSFFPQKHRGH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.11 | 2.1104528134812 | 9.6e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)