Host taxon 10090
Protein NP_001186266.1
MICOS complex subunit Mic26 isoform 2
Mus musculus
Gene Apoo, UniProt Q9DCZ4
>NP_001186266.1|Pseudomona aeruginosa PA01|MICOS complex subunit Mic26 isoform 2
MPFWGCGEDEARSGRCRVIQRSVGPASLSLLTFRVYAAPKKDSPHKSYMKIDELSLYSVPEGQSKYVEEPRTQLEENISQLRHHCEPYTSFCQEIYSHTKPKVDHFVQWGVDNYNYLQNAPPGFFPRLGVIGFAGFVGLLFARGSKIKKLVYPPFFMGLGASVYYPQQAITIAQITGEKLYDWGLRGYIVIEDLWKQNFQKPGNVKNSPGNK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.52 | -2.52279170560457 | 0.0006 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)