Host taxon 10090
Protein NP_067529.2
methyltransferase-like protein 9 precursor
Mus musculus
Gene Mettl9, UniProt Q9EPL4
>NP_067529.2|Pseudomona aeruginosa PA01|methyltransferase-like protein 9 precursor
MRLLAGWLCLSLASVWLARRMWTLRSPLSRSLYVNMTSGPGGPAAAAGGGKDTHQWYVCNREKLCESLQSVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLRINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTQGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVVEAFTRLPYLCEGDMYNDYYVLDDAVFVLRPV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.64 | 0.643756714983659 | 0.00033 | 32071273 | |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)