Host taxon 10090
Protein NP_080962.1
methyltransferase-like 26
Mus musculus
Gene Mettl26, UniProt Q9DCS2
>NP_080962.1|Pseudomona aeruginosa PA01|methyltransferase-like 26
MMMAAAAERNKEPILSVLRQYVDPAQRCVRVLEVASGSGQHAAHFAQAFPNAEWQPSDVDQRCLDSIAATTRAQGLSNVKAPLYLDVTWEWEQWGGIPPRSLDLLLCINMIHISPLNCTEGLFRAAGHLLKTKAVLITYGPYAVNGKISPQSNVDFDLTLRCRNPEWGLRDTVLLEELGQASGLVLERMVDMPANNKCLIFRKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.2 | -1.20487143458092 | 0.018 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)