Host taxon 10090
Protein NP_082902.1
methylmalonyl-CoA epimerase, mitochondrial isoform 1 precursor
Mus musculus
Gene Mcee, UniProt Q9D1I5
>NP_082902.1|Pseudomona aeruginosa PA01|methylmalonyl-CoA epimerase, mitochondrial isoform 1 precursor
MRRVVKAAALAAGATGLFSRVQTSVAIGRSFSTPQSQFQESSPVWKLGRLNHVAVAVPDLEKASSFYRDVLGAQVSEVVPLPEHGVSVVFVNLGNTKMELLHPLGSDSPITGFLQKNKAGGMHHVCIEVDNISAAVMDLKKKKIRSLSDEAKIGAHGKPVIFLHPKDCGGVLVELEQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.36 | -1.35838119298548 | 0.0003 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)