Host taxon 10090
Protein NP_080238.2
methylmalonic aciduria and homocystinuria type C protein homolog
Mus musculus
Gene Mmachc, UniProt Q9CZD0
>NP_080238.2|Pseudomona aeruginosa PA01|methylmalonic aciduria and homocystinuria type C protein homolog
MEPRVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPFPGPTLAFLVLSTPAMFDRALKPFLKSCHFQTLRDPVDQCVSYHLRSVTEKFPEVHMEVIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVDADPWGTQHIAGVCIHPRFGGWFAIRGVMLLPGIEVPNLPPRKPPDCVPTRAGRITLLEGFNFHWRDWTYRDAVTPEERYSEEQKIYFSTPPAQRLALLGLAQPSEHPSTTSELPLSLLTKPQNSRRARSWLSPSVSPPVSPGP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.31 | -2.30516695478799 | 0.00052 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)