Bacterial taxon 208964
Protein WP_003089312.1
metalloregulator ArsR/SmtB family transcription factor
Pseudomona aeruginosa PA01
Gene arsR, UniProt Q9I1J7
>WP_003089312.1|Pseudomona aeruginosa PA01|metalloregulator ArsR/SmtB family transcription factor
MPSPAEVFKCLADETRVRATLLIVDQGELCVCELMCALADSQPKISRHLAQLRSAGLLLDRRQGQWVYYRLNPALPAWIHEVLQVTLRANGDWLQADAARLRDMDGRPQRASACCQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●○○ -2.65 | -2.64635322992983 | 1.6e-12 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)