Host taxon 10090
Protein NP_542370.3
metalloproteinase inhibitor 4 isoform 1 precursor
Mus musculus
Gene Timp4, UniProt Q9JHB3
>NP_542370.3|Pseudomona aeruginosa PA01|metalloproteinase inhibitor 4 isoform 1 precursor
MPWSPLAALSWALVLRLLALLWPPGRGEACSCAPAHPQQHFCHSALVIRAKISSEKVVPASKDPADTQKLIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSHKQYLLTGQILSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGICSWYRGHLHLRKEYVDIIQP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.98 | -2.98072310554354 | 0.0027 | 32071273 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)