Host taxon 10090
Protein NP_035724.2
metalloproteinase inhibitor 2 precursor
Mus musculus
Gene Timp2, UniProt Q6PI17
>NP_035724.2|Pseudomona aeruginosa PA01|metalloproteinase inhibitor 2 precursor
MGAAARSLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.33 | -0.330543038735817 | 3.6e-7 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)