Host taxon 10090
Protein NP_079934.2
membrane-spanning 4-domains subfamily A member 4D
Mus musculus
Gene Ms4a4d, UniProt Q99N05
>NP_079934.2|Pseudomona aeruginosa PA01|membrane-spanning 4-domains subfamily A member 4D
MQGLAQTTMAVVPGGAPPSENSVIKSQMWNKNKEKFLKGEPKVLGAIQVMIAFINFSLGIIIILNRVSERFMSVLLLAPFWGSIMFIFSGSLSIAAGVKPTKAMIISSLSVNTISSVLAVAASIIGVISVISGVFRQFRSQPAIASLDVLMTILNMLEFCIAVSVSAFGCKASCCNSSEVLVVLPSNSAVTVTAPPMILQPLPPSECQGKNVPENLYRNQPGEIV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.8 | 0.804565395659052 | 0.00025 | 32071273 | |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)