Host taxon 10090
Protein NP_778167.1
membrane magnesium transporter 2 precursor
Mus musculus
Gene Mmgt2, UniProt Q8R3L0
>NP_778167.1|Pseudomona aeruginosa PA01|membrane magnesium transporter 2 precursor
MVAWLWKVLMGVGLFALTHAAFSAAQHRSHARLTEKKYEPLPADIVLQTLLAFALTCYGVVHTAGDFRDRDATSELKDMTFDTLRNRPSFYVFHRSGYRLFQRPDSTHSSNLSASSSDLPLKF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.36 | -2.36213163290685 | 3.4e-8 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)