Host taxon 10090
Protein NP_613062.1
mediator of RNA polymerase II transcription subunit 10 isoform 1
Mus musculus
Gene Med10, UniProt Q9CXU0
>NP_613062.1|Pseudomona aeruginosa PA01|mediator of RNA polymerase II transcription subunit 10 isoform 1
MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.08 | 1.0794004928452 | 2.5e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)