Host taxon 10090
Protein NP_001276669.1
maturin isoform a
Mus musculus
Gene Mturn, UniProt Q8CGA4
>NP_001276669.1|Pseudomona aeruginosa PA01|maturin isoform a
MDFQQLADVAEKWCSSTPFELIAAEETERRMDFYADPGVSFYVLCPDNGCGDSFHVWSESEDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.5 | -0.496639704952128 | 0.016 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)