Bacterial taxon 208964
Protein WP_003114897.1
MarR family transcriptional repressor MexR
Pseudomona aeruginosa PA01
Gene mexR, UniProt P52003
>WP_003114897.1|Pseudomona aeruginosa PA01|MarR family transcriptional repressor MexR
MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQPLEDI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ -1.56 | -1.55632496187028 | 7.1e-33 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)