Host taxon 10090
Protein NP_001028403.1
mapk-regulated corepressor-interacting protein 1
Mus musculus
Gene Mcrip1, UniProt Q3UGS4
>NP_001028403.1|Pseudomona aeruginosa PA01|mapk-regulated corepressor-interacting protein 1
MTSSPVSRVVYNGKRNSSPRSPTNSSEIFTPAHEENVRFIYEAWQGVERDLRSQLSSGERCLVEEYVEKVPNPSLKTFKPIDLSDLKRRNTQDAKKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.72 | -0.723549693730811 | 0.0017 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)