Host taxon 10090
Protein NP_081178.1
malignant T-cell-amplified sequence 1 isoform 1
Mus musculus
Gene Mcts1, UniProt Q9DB27
>NP_081178.1|Pseudomona aeruginosa PA01|malignant T-cell-amplified sequence 1 isoform 1
MFKKFDEKENVSNCIQLKTSVIKGIKNQLLEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.46 | -1.45782141418435 | 0.00019 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)