Host taxon 10090
Protein NP_075886.1
magnesium-dependent phosphatase 1
Mus musculus
Gene Mdp1, UniProt Q9D967
>NP_075886.1|Pseudomona aeruginosa PA01|magnesium-dependent phosphatase 1
MTRLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQSLGVPVAAASRTSEIQGANQLLELFDLGKYFIQREIYPGSKVTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIRDGMSLQTLTQGLETFAKAQAGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.58 | -1.58109528959494 | 1.6e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)