Host taxon 10090
Protein NP_079755.1
M-phase-specific PLK1-interacting protein
Mus musculus
Gene Mplkip, UniProt Q9D011
>NP_079755.1|Pseudomona aeruginosa PA01|M-phase-specific PLK1-interacting protein
MHRPNFRPPTPPYPSPGIGGWGGGNNFRGALGGGPRPPSPRDGYGSPHHTPPCGPRARPYGSSQSPRHGGNFSGARFGSPSPGGYPGSYSRSPAGSQHQFGYSPGQQQTYPQGSPRTSTPFGSGRGREKRMSNELESYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.84 | -1.83840969834844 | 1.5e-7 | 32071273 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)