Bacterial taxon 208964
Protein WP_003084610.1
LysE family transporter
Pseudomona aeruginosa PA01
Gene chpE, UniProt O87005
>WP_003084610.1|Pseudomona aeruginosa PA01|LysE family transporter
MLAIFLAALLFGFAFNVSPGAVFSETLRRGLTGGFRPALLVQLGSLIGDAVWALLGLTGLALLLGYEQVRIPLTLACAAYLAWLGVQGLRDAWSPPLAAEDAGEQGRNAFGAGAAISLSNPKNVVYWGALGSALAGIVDGTPNQAQSLVFFAGFMLSSLIWCFCCAALVDWLRRNTSLFWHRVSYAGCGVLLLGLAGLALRGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.93 | 0.927349004550506 | 0.00072 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)