Host taxon 10090
Protein NP_001153183.1
lymphocyte antigen 96 isoform B precursor
Mus musculus
Gene Ly96, UniProt Q9JHF9
>NP_001153183.1|Pseudomona aeruginosa PA01|lymphocyte antigen 96 isoform B precursor
MLPFILFSTLLSPILTESEKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPKLPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.96 | 1.9610506836806 | 0.036 | 32071273 | |
Retrieved 1 of 4 entries in 0.4 ms
(Link to these results)