Host taxon 10090
Protein NP_001258345.1
lymphocyte antigen 6A-2/6E-1 precursor
Mus musculus
Gene Ly6a, UniProt P05533
>NP_001258345.1|Pseudomona aeruginosa PA01|lymphocyte antigen 6A-2/6E-1 precursor
MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGGSTWTMAGVLLFSLSSVLLQTLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.44 | 0.439173187868015 | 1.1e-5 | 32071273 | |
Retrieved 1 of 1 entries in 2.4 ms
(Link to these results)