Host taxon 10090
Protein NP_035968.1
ly-6/neurotoxin-like protein 1 precursor
Mus musculus
Gene Lynx1, UniProt P0DP60
>NP_035968.1|Pseudomona aeruginosa PA01|ly-6/neurotoxin-like protein 1 precursor
MTHLLTVFLVALMGLPVAQALECHVCAYNGDNCFKPMRCPAMATYCMTTRTYFTPYRMKVRKSCVPSCFETVYDGYSKHASATSCCQYYLCNGAGFATPVTLALVPALLATFWSLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.84 | -1.84498901995229 | 3.0e-10 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)