Host taxon 10090
Protein NP_653142.2
low affinity immunoglobulin gamma Fc region receptor IV precursor
Mus musculus
Gene Fcgr4, UniProt A0A0B4J1G0
>NP_653142.2|Pseudomona aeruginosa PA01|low affinity immunoglobulin gamma Fc region receptor IV precursor
MWQLLLPTALVLTAFSGIQAGLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQITFCLLIGLLFAIDTVLYFSVRRGLQSPVADYEEPKIQWSKEPQDK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.48 | 1.47624704735549 | 4.4e-6 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)