Host taxon 10090
Protein NP_034318.2
low affinity immunoglobulin gamma Fc region receptor III isoform 1 precursor
Mus musculus
Gene Fcgr3, UniProt A0A0B4J1M6
>NP_034318.2|Pseudomona aeruginosa PA01|low affinity immunoglobulin gamma Fc region receptor III isoform 1 precursor
MTLDTQMFQNAHSGSQWLLPPLTILLLFAFADRQSAALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNWSSIRSQVQSSYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTAFSLVMCLLFAVDTGLYFYVRRNLQTPRDYWRKSLSIRKHQAPQDK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.24 | 2.23640482740315 | 4.0e-54 | 32071273 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)