Host taxon 10090
Protein NP_064428.1
linker for activation of T-cells family member 2 isoform a precursor
Mus musculus
Gene Lat2, UniProt Q9JHL0
>NP_064428.1|Pseudomona aeruginosa PA01|linker for activation of T-cells family member 2 isoform a precursor
MSAELELLWPVSGLLLLLLGATAWLCVHCSRPGVKRNEKIYEQRNRQENAQSSAAAQTYSLARQVWPGPQMDTAPNKSFERKNKMLFSHLEGPESPRYQNFYKGSNQEPDAAYVDPIPTNYYNWGCFQKPSEDDDSNSYENVLVCKPSTPESGVEDFEDYQNSVSIHQWRESKRTMGAPMSLSGSPDEEPDYVNGDVAAAENI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.78 | 2.7800887224745 | 8.7e-26 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)