Host taxon 10090
Protein NP_032547.1
leukotriene C4 synthase isoform 1
Mus musculus
Gene Ltc4s, UniProt Q60860
>NP_032547.1|Pseudomona aeruginosa PA01|leukotriene C4 synthase isoform 1
MKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQMLLPMA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.69 | -1.69332476114333 | 0.034 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)