Host taxon 10090
Protein NP_081302.2
leucine-rich repeat-containing protein 46
Mus musculus
Gene Lrrc46, UniProt Q9DAP0
>NP_081302.2|Pseudomona aeruginosa PA01|leucine-rich repeat-containing protein 46
MPGDEQEAKKAAQRTEEGVHITEALITKRNLTFPGDEDLSEKMFHTLGELETVRLDGEGITCIGNLEKLRNIHSLYLQSNKIQRIENLACITSLRFLSLARNQIRHVENLLDLQYLQFLDLSENLIETLKLDELPESLLILNLCGNPCTNQEGYRKMVIGALPLLLDLDKQPILERWTSDEEDKSSDDDDEFPELNGPFCAERGFFKDLEQELHQHQERRQQAALTEHLSRMETQPVLTDLPLLPAVPMAGDCSSTATDQPGKESAPKATSSTQTASTTKKQVSKNQKSSVQARKGALAATTSKTSQAATPSMTKMTNKKSTK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -5.09 | -5.08528519468596 | 0.00061 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)