Host taxon 10090
Protein NP_001033012.2
leucine-, glutamate- and lysine-rich protein 1 isoform 2
Mus musculus
Gene Lekr1, UniProt B2RVN1
>NP_001033012.2|Pseudomona aeruginosa PA01|leucine-, glutamate- and lysine-rich protein 1 isoform 2
MDRHIPMHALPEEIQKMSPEETVCKYCGVSYLILHEFKAMEEKLKAVQEEMKFYQGSVEREKKLQEKLQSLSQEFEQYKSDSESKKARSEYVSCLLFSFKANSRFGWHGGTCLKFQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.94 | -1.93940297630171 | 0.00055 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)