Host taxon 10090
Protein NP_778201.1
leptin receptor gene-related protein
Mus musculus
Gene Leprot, UniProt O89013
>NP_778201.1|Pseudomona aeruginosa PA01|leptin receptor gene-related protein
MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGLPVVLARVDVIKWGACGLVLAGNAVIFLTIQGFFLVFGRGDDFSWEQW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.42 | -0.417539277613499 | 0.0057 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)