Host taxon 10090
Protein NP_076113.1
lecithin retinol acyltransferase
Mus musculus
Gene Lrat, UniProt Q9JI60
>NP_076113.1|Pseudomona aeruginosa PA01|lecithin retinol acyltransferase
MKNPMLEAASLLLEKLLLISNFKLFSVSVPGGGTGKNRPYEISSFVRGDVLEVSRTHFIHYGIYLGENRVAHLMPDILLALTNDKERTQKVVSNKRLLLGVICKVASIRVDTVEDFAYGADILVNHLDGTLKKKSLLNEEVARRAEQQLGLTPYSLLWNNCEHFVTYCRYGSRISPQAEKFYDTVKIIIRDQRSSLASAVLGLASIVYTGLASYMTLPAICIPFCLWMMSG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.5 | -2.49542092401067 | 5.1e-48 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)