Bacterial taxon 208964
Protein WP_003099390.1
L-methionine sulfoximine N-acetyltransferase
Pseudomona aeruginosa PA01
Gene pitA, UniProt Q9HUU7
>WP_003099390.1|Pseudomona aeruginosa PA01|L-methionine sulfoximine N-acetyltransferase
MSASIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDTRARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ 1.02 | 1.02358823331666 | 0.00012 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)