Host taxon 10090
Protein NP_079603.1
keratinocyte-associated protein 2 isoform 1
Mus musculus
Gene Krtcap2, UniProt Q5RL79
>NP_079603.1|Pseudomona aeruginosa PA01|keratinocyte-associated protein 2 isoform 1
MVVGTGTSLALSSLLSLLLFAGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATAPVLTPAKITGKGKKRN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.61 | -1.60650945697289 | 0.00024 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)