Host taxon 10090
Protein NP_032284.1
jupiter microtubule associated homolog 1
Mus musculus
Gene Jpt1, UniProt P97825
>NP_032284.1|Pseudomona aeruginosa PA01|jupiter microtubule associated homolog 1
MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPAEQPVRKNKMASNIFGTPEENPPSWAKSAGSKSSGGREDSESPGTQRSNSSEASSGDFLDLKGEGDMHENVDTDFQANLAQMEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.46 | 0.457208185090923 | 0.0091 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)