Host taxon 10090
Protein NP_081197.1
iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
Mus musculus
Gene Isca1, UniProt Q9D924
>NP_081197.1|Pseudomona aeruginosa PA01|iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYSLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFHV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.66 | 0.660235758087 | 1.7e-9 | 32071273 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)