Host taxon 10090
Protein NP_080207.1
intraflagellar transport protein 27 homolog
Mus musculus
Gene Ift27, UniProt Q9D0P8
>NP_080207.1|Pseudomona aeruginosa PA01|intraflagellar transport protein 27 homolog
MVKLAAKCILAGDPAVGKTALVQMFRSDGTHFQKNYTLTTGVDLVVKTVPVLDTNDSVELFIFDSAGKELFSEMLDKLWENPNVLCLVYDVTNEQSFISCTKWLEKVRSQTSGISLPGVLVGTKTDLAGRQTVDSAQAQVWALSQGLEFFETSVKEMDNYEAPFHCLAKQFYQLYREKVDIFHTLV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.33 | -1.32974654800451 | 0.0097 | 32071273 | |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)