Host taxon 10090
Protein NP_082670.1
intraflagellar transport protein 25 homolog
Mus musculus
Gene Hspb11, UniProt Q9D6H2
>NP_082670.1|Pseudomona aeruginosa PA01|intraflagellar transport protein 25 homolog
MRKVDLCSVTEGTEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVKIEKLVIQSYLVRTLRIEKTTSKEPLDFEQWVEKDLVHTEGQLQNEEIVARDGYATFLRFIIVSAFDHFASVHSISAEGLTVSSLP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -5.48 | -5.47859682012474 | 0.00067 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)