Host taxon 10090
Protein NP_444325.2
interleukin-24
Mus musculus
Gene Il24, UniProt Q925S4
>NP_444325.2|Pseudomona aeruginosa PA01|interleukin-24
MLTEPAQLFVHKKNQPPSHSSLRLHFRTLAGALALSSTQMSWGLQILPCLSLILLLWNQVPGLEGQEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.69 | 4.68835961521218 | 0.0011 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)