Host taxon 10090
Protein NP_001009940.1
interleukin-19 isoform 1 precursor
Mus musculus
Gene Il19, UniProt Q8CJ70
>NP_001009940.1|Pseudomona aeruginosa PA01|interleukin-19 isoform 1 precursor
MKTQCASTWLLGMTLILCSVHIYSLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.46 | 5.46048326224365 | 0.0046 | 32071273 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)