Host taxon 10090
Protein NP_034661.1
interleukin-18-binding protein precursor
Mus musculus
Gene Il18bp, UniProt Q9Z0M9
>NP_034661.1|Pseudomona aeruginosa PA01|interleukin-18-binding protein precursor
MTMRHCWTAGPSSWWVLLLYVHVILARATSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.85 | 1.84745699505982 | 1.6e-15 | 32071273 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)