Host taxon 10090
Protein NP_034682.1
interleukin-17A precursor
Mus musculus
Gene Il17a, UniProt Q62386
>NP_034682.1|Pseudomona aeruginosa PA01|interleukin-17A precursor
MSPGRASSVSLMLLLLLSLAATVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 8.93 | 8.93385064937109 | 4.5e-12 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)