Host taxon 10090
Protein NP_001241676.1
interleukin-15 preproprotein
Mus musculus
Gene Il15, UniProt P48346
>NP_001241676.1|Pseudomona aeruginosa PA01|interleukin-15 preproprotein
MKILKPYMRNTSISCYLCFLLNSHFLTEAGIHVFILGCVSVGLPKTEANWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.31 | 1.30594612903033 | 0.00026 | 32071273 | |
Retrieved 1 of 4 entries in 1.1 ms
(Link to these results)