Host taxon 10090
Protein NP_109619.1
interferon-induced transmembrane protein 2
Mus musculus
Gene Ifitm2, UniProt Q99J93
>NP_109619.1|Pseudomona aeruginosa PA01|interferon-induced transmembrane protein 2
MSHNSQAFLSTNAGLPPSYETIKEEYGVTELGEPSNSAVVRTTVINMPREVSVPDHVVWSLFNTLFFNACCLGFVAYAYSVKSRDRKMVGDVVGAQAYASTAKCLNISSLIFSILMVIICIIIFSTTSVVVFQSFAQRTPHSGF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.49 | 1.48638992579379 | 2.9e-68 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)