Host taxon 10090
Protein NP_001028804.1
interferon induced transmembrane protein 6
Mus musculus
Gene Ifitm6, UniProt Q3SXF0
>NP_001028804.1|Pseudomona aeruginosa PA01|interferon induced transmembrane protein 6
MVKRDPDSAPVPSTVVCINSDVIQPDHITWSTFNTVFMNGCCLGFIAYIYSVKSRDRKMVGDMTGAQSHASTAKILNILALVISLIFYIMLIVLYSFNLLGNQR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 6.57 | 6.57262746435959 | 1.8e-66 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)